Loading...

How to Date Keith in Date Everything! - Complete Romance Guide & All Endings

Keith

πŸ“ Location: Hidden in the secret crawl space under a rug in the office closet downstairs⭐ Difficulty: Very Hard (5/5)
officesecretkeycrawl-spacemysterious

Overview

Keith is one of Date Everything's most mysterious and challenging romance options. This magical key has a complex backstory involving past relationships, emotional manipulation, and a secretive nature that makes him both intriguing and difficult to approach. Keith's story involves multiple characters including Mac, and players must navigate carefully to avoid getting locked out of romantic possibilities.

Warning: Keith has a story with mature themes including emotional manipulation and trust issues. His romance requires careful dialogue choices and emotional intelligence.

Where to Find Keith

Location: The Crawl Space entrance is hidden under a rug in the office closet downstairs. By taking off the Dateviators and interacting with the rug, players can roll the rug back and enter the Crawl Space where Keith can be found on the ground.

Step-by-Step Location Guide:

  1. Go to the first floor of the house
  2. Enter the office room
  3. Open the closet door
  4. Remove your Dateviators (dating glasses)
  5. Look for the rug on the closet floor
  6. Interact with the rug to roll it back
  7. Enter the revealed Crawl Space
  8. Find Keith on the ground inside

Character Routes & Endings

πŸ’• Love Route

The love route with Keith requires patience, empathy, and careful navigation of his trust issues. He's been hurt before and will test your commitment.

Key Strategy:

  • Be supportive during emotional moments
  • Don't question his motives or call him manipulative
  • Help with the investigation involving Mac
  • Show understanding about his complicated past
  • Choose dialogue options that demonstrate genuine care

Critical Encounters:

Third Encounter - Building Trust:

  • Choose: "Did you do something wrong?"
  • Choose: "Did the previous owner lose you?"

Seventh Encounter - The Investigation (Most Important):

  • "It's all in how we ask him, my friend…"
  • "We need to hack into an online journal, Mac."
  • "That's exactly correct, Mac. Sounds fun, right?"
  • "Mac, please? Keith is really suffering here."
  • "So we've got to guess the password?"
  • "Keith, any ideas?"
  • CRITICAL: Choose any option that doesn't question his innocence
  • "Did you just say 'crypto account passwords?'"
  • "Oh. Right. Of course not."
  • "Is that it?"
  • "I'm sorry Keith."
  • Final Choice: "Maybe we can start with our first kiss?"

🀝 Friendship Route

The friendship route follows the same path as the love route but concludes differently.

Key Steps:

  1. Complete all the love route encounters successfully
  2. Build trust and support Keith through his difficulties
  3. In the final interaction, choose: "I'd love that Keith. Your friendship means a lot to me."

This choice will seal you into the friends ending while maintaining a positive relationship.

πŸ’” Hate Route

The hate route involves rejecting Keith's vulnerable moments and exposing his manipulative tendencies.

Methods to Trigger Hate Route:

  • Refuse to help him during key story moments
  • Openly question his motives throughout conversations
  • Call him out as a master manipulator
  • Choose hostile or unsympathetic dialogue options
  • Don't support him during the investigation with Mac

Alternative Hate Trigger:

  • Show any indication that you're catching on to his manipulative behavior
  • Call him out directly during any interaction
  • This will automatically lead to a negative ending

Important Tips & Warnings

Known Bugs & Issues

  • Critical Bug: If you click to find another option instead of saying you doubt his innocence during the Mac investigation, the conversation may end and become unrecoverable
  • This bug has been reported on multiple platforms and can break the game progression
  • Save before the seventh encounter as a precaution

Romance Strategy

  • Keith values emotional support over direct confrontation
  • His past experiences make him sensitive to criticism
  • The investigation sequence with Mac is the most critical part of his story
  • Missing key dialogue choices can permanently lock you out of the romance

Character Psychology

Keith is a complex character dealing with:

  • Past emotional trauma from previous relationships
  • Trust issues that manifest as manipulative behavior
  • A need for validation and genuine connection
  • Fear of abandonment that drives his testing behavior

Common Mistakes to Avoid

  1. Questioning His Innocence: Never doubt Keith during the investigation - this is an instant relationship killer
  2. Being Too Direct: Keith responds better to gentle, supportive approaches than direct confrontation
  3. Missing the Bug: Be aware of the dialogue bug during the Mac sequence
  4. Rushing the Romance: Keith's story unfolds slowly - patience is essential
  5. Ignoring Red Flags: While you shouldn't call him out, be aware that Keith does have manipulative tendencies

Realization Recipe

Once you've successfully completed Keith's romance, you can use him in realization recipes to create new items or unlock additional content in Date Everything.

Related Characters

Keith's story intersects with several other characters:

  • Mac: Plays a crucial role in Keith's investigation storyline
  • Other keys and secret items throughout the house may have connections to Keith's backstory